Trimco 3094b4

On the street of East 39th Avenue and street number is 15000. So please order the Trimco products you need and we will ship them right to you. TRIMCO 1015-3 HEAVY DUTY PUSH/PULL PLATE 4 X 16 STAINLESS STEEL Cut for Cylinder. Pull bars: Trimco #1191-4J, or Kawneer "CO-9". Includes filler bar. Company profile Colombia. We have been able to blend the best of the wholesale distribution model, contract house, high end showroom, and hollow metal door and frame fabrication in order to serve our wide range of customers. Track Shipments Shipment Profile 3 Export Shipments 13 Import Shipments 323 Malta Streetbrooklyn Ny 11207. border), customer pays balance from there on. 6 circuit, EM6352ZSC3B4. 'Trimco- Plastic and Rubber Edge Trims and Seals. Your post's title Your store hasn’t published any blog posts yet. Orders received during non-business days are processed on the next business day. Intermediate pivots: Ives #7215-INT, or Kawneer standard intermediate pivot. Must have an open account with Trimco. For more information you can contact Trimco Carpentry by phone (416) 755-0001 or by mail East York, Ontario, M4B 1Z5. 22a008cd88c5220371286694a4b58169bb4748dd77d250369e147f429c581bf1. 3910N is less the faceplate for flush floor mount configuration. Supply Chain Intelligence about: Trimco S. TriMet provides bus, light rail and commuter rail transit services in the Portland, Oregon, metro area. MARRUECOS 1953 Cifras, B4 EDIFIL nº 382 y 383 * *. com is ranked 43,259,719, with an estimated < 300 monthly visitors a month. 605 1895-4b. Latest posts. BLACK - 52" Coordinator with Filler Bar, Openings 87" to 95" COORDINATOR,STP MTD,87-95,UL, Black Usually Ships in 3-4 Weeks List Price: $345. cust atlas-s. To Purchase # 3094S. 이 전화번호(0220603094 / 02-2060-3094)에 대한 정보를 공유해주세요. Phone: (416) 755-0001. Get reviews, hours, directions, coupons and more for Trimco. Printer Ender5 Reproduction steps Issue1 (4. View trimco04's current activities on Fixya. Trimco 3094B4. 3910N is less the faceplate for flush floor mount configuration. Trimco Interior Design. 3094B4–87-95” Opening $145. * * nuevos con goma original sin señal de charnela. Full information about Trimco Carpentry in East York, Ontario, Canada: phone. Pill with imprint B 4 is White, Rectangle and has been identified as Buspirone Hydrochloride 15 mg. Tx hash: b2d3094ca4e22c7cdb301d931b3ff53840cc0c0438591b3d3e5989b37a014040. Click to view other data about this site. The Series 3094 Coordinators are designed for use in conjunction with rugged Trimco Series 3800 low-friction Automatic and Semi-Automatic Flushbolts. is committed to the protection and conservation of the environment. It is supplied by Accord Healthcare Inc. Радио Maximum: Хит-парад двух столиц. Voltage Detector, High-Precision, EM6352ZSC3B4. TSG BmxDirt Casco Recon Graphic DesignCap bianca. We have been able to blend the best of the wholesale distribution model, contract house, high end showroom, and hollow metal door and frame fabrication in order to serve our wide range of customers. Mexico- Trimco pays freight on all orders of $1,000 or more (up to the U. Home; web; books; video; audio; software; images; Toggle navigation. 19 一步之遥 , 功亏一篑? 来源: dindindon 于 2019-11-13 14:02:51 [档案] [博客] [旧帖] [给我悄悄话] 本文已被阅读:. Team Associated's Area 51 designers optimized the B4. Trimco 3096 Mounting Bracket Over 2-1/4" Stop UL, Black Your Price: $23. See Trimco S. The low profile design requires no mounting brackets for stop mounting and goes almost unnoticed when the doors are closed. The Series 3094 Coordinators are designed for use in conjunction with rugged Trimco Series 3800 low-friction Automatic and Semi-Automatic Flushbolts. Welcome to Trimco LLC. Get reviews, hours, directions, coupons and more for Trimco. BLACK EXAMPLE Stop Mounted Coordinator * Dimensions are informational only. With many unique and interesting new product. Learn from their stories and discover if Trimco Finish is right for you! What don't you like about working at Trimco Finish? "You never knew if you had a job the next day due to the building industry. Trimco is a full line manufacturer of all things trim and auxiliary hardware related. 0797b9f3094fd973e813c1a060ee32e0. Pill with imprint B 4 is White, Rectangle and has been identified as Buspirone Hydrochloride 15 mg. d46b3094de31df4733dc6d6e76f3c3df. TSG BmxDirt Casco Recon Graphic DesignCap bianca. Research Trimco Finish with over reviews from real employees. ddf1e109eaf4035cf22016e8d6194bd06d0fa9a516dc911d654e4b7dbcf433fa. Templates are available at www. Sit back, relax and enjoy many hours of mobile gaming fun. Trimco manufactures custom door hardware and architectural hardware including elegant door pulls, heavy duty and anti-vandal products, push and pull plates, kick plates and door stops. Geological Survey Fact Sheet 2010-3094, 4 p. The 3094 Stop Mounted Door Coordinators are designed to give extremely high-end reliability, low friction and low-noise performance at a moderate price. 10 Best Side Hustle Ideas: How I Made $600 in One Day - Duration: 16:07. 3316, For hand-operated sockets and accessories with square drive as per DIN 3120, Country of Origin: Germany, 3/8 29 mm GEDORE 3094 Coupler Tools & Equipment Wrenches, to DIN 3122, to DIN 3122, GEDORE 3094 Coupler, ISO 1174. Trimco® (A Division of Trim-Gard Company Limited) was founded in 1968 to provide the market-place with a reliable source of plastic extrusions. Trimco Carpentry. 19 一步之遥 , 功亏一篑? 来源: dindindon 于 2019-11-13 14:02:51 [档案] [博客] [旧帖] [给我悄悄话] 本文已被阅读:. 630 1191e-5sgt. Welcome aboard!. cust atlas-s. 'Trimco- Plastic and Rubber Edge Trims and Seals. Welcome to Trimco LLC. Subtype: 0. Supply Chain Intelligence about: Trimco S. Transaction cf4265b0faf11675d75fa535bb1acbe35e81f69b19ac4d60bee22dfd96ad3094. TRIMCO specializes in top-quality hardware for public buildings, schools, offices, hospitals, and retail stores. 507 S 4th St, Dunlap (IL), 61525-8053, United States. Through teamwork and ongoing improvement efforts, the Company strives to minimize environmental damages with the responsible management of industrial solid waste. tomotaka matuda. 'Trimco- Plastic and Rubber Edge Trims and Seals. Governor is RUSSELL WILLIAM TREMBLAY. Trimco International Holdings Limited manufactures garment labels, tags, and trimming products for blue chip global apparel companies. Choose from a list of 1 trimco logo vectors to download logo types and their logo vector files in AI, EPS, CDR & SVG Formats along with their jpg or png logo images. 612 1017-2b. _widgetsettings. 628 1191g-3. Trimco Locations & Hours near London. trimco-upvc. When you order products from Anixter. White River. 6 circuit, EM6352ZSC3B4. SEC Form 424B4 is the prospectus form that a company must file to disclose information they refer to in SEC Forms 424B1 and 424B3. Leukotriene B4 | C20H32O4 | CID 5280492 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more. Trimco® (A Division of Trim-Gard Company Limited) Seals & Gaskets are constantly updated, specifications are subject to change without notice and without incurring obligation. Tiesiskā forma. When you order products from Anixter. Last Updated: 05/04/2018. Trimco is a door hardware specialist and offers variety of solutions under one roof. Поделиться на Facebook. Similar businesses near Trimco: 1 New Things LLC. Sabiedrība ar ierobežotu atbildību "TRIMCO VV". 625 1807-25-ph. lượt xem 0. Product Identifiers. Check company TRIMCO CONSTRUCTION, INC. AC B4XS30; DT 23-SEP-2008, integrated into UniProtKB/TrEMBL. An industry leader, TRIMCO offers the broadest array of heavy-duty and functional trim products in the industry. Let Trimcos Build Your Dream!. Trimco manufactures custom door hardware and architectural hardware including elegant door pulls, heavy duty and anti-vandal products, push and pull plates, kick plates and door stops. Items formerly offered, but not in this price list are available by special order. Trimco Millwork is located in Aurora city of Colorado state. Trimco produces only superior quality functional hardware that is also, in the same time, creative and attractive. This Trimco project included all interior trim and finishing work in this $4 million home. Fully automatic, the 3094 Stop-Mounted Coordinators are used. Buy Trimco 1270WV. Answered all the questions that I had. September 26 at 10:52 AM · The Decorative Plastic Extruded Trim featured is N4000 Series ( N4002-Black, N4014-Silver ) which is 2" wide and can be purchased in a 20' and 100' length. Let's Talk Money! with Joseph Hogue, CFA 785,635 views. Pill with imprint B 4 is White, Rectangle and has been identified as Buspirone Hydrochloride 15 mg. TRIMCO GmbH Zürcherstrasse 2 8142 Uitikon. It is supplied by Accord Healthcare Inc. Extruded metal. ♫ Look in my eyes, what do Now Punk is back, Bros B4 Elbows is now a trio, and an emergency podcast must be recorded. In the United Kingdom, Trimco. 77b3094d97e34ff2f33755cd5810857660a8cbebe07fe9f3ed8326e9af73f4d3. BLACK EXAMPLE Stop Mounted Coordinator * Dimensions are informational only. An industry leader, TRIMCO offers the broadest array of heavy-duty and functional trim products in the industry. Trimco1 is ranked 43,259,719 in the United States. (Юнион) AR-1361 Фигурка " Плюшевый Мишка" с цв. 628 1191g-3. _widgetsettings. Trimming Machine & Rosin Press Rentals. Trimco manufactures custom door hardware and architectural hardware including elegant door pulls, heavy duty and anti-vandal products, push and pull plates, kick plates and door stops. Click to view other data about this site. after the addition, this building will have a total floor area of about 64,750 square feet. One size universal coordinator for all pairs of doors up to 8' wide, available in matte black finish. Extruded metal. Eschler Bourne Associates AIA Architects 555 South 300 East Salt Lake City, UT, 84111 (801)322-2900: Erdmann Jon E Architect 2180 South 1300 East Salt Lake City, UT, 84106. Fully automatic, the 3094 Stop-Mounted Coordinators are used to sequence pairs of doors where one leaf must close before the other. This video is to bring you a closer look at the Trimco 562-4. On the street of East 39th Avenue and street number is 15000. Any questions on the Trimco 4874 4" Surface Bolt in a satin chrome finish or any other Trimco product, who is a full line manufacturer of all things trim and auxiliary related. TRIMCO# 3096OA 3" x35"SW over 2-1/4"M Steel600 BlackMounting BracketFor mounting stop-appliedhardware. Phone: (416) 755-0001. We also import some door hardware products from companies around the world. R50-3094-000. Door Holder 1220 from $24. Flat Black finish is standard. 3910N is less the faceplate for flush floor mount configuration. TRIMCO specializes in top-quality hardware for public buildings, schools, offices, hospitals, and retail stores. Through teamwork and ongoing improvement efforts, the Company strives to minimize environmental damages with the responsible management of industrial solid waste. 4B only) Load Cura Attempt to resize the window. 622 1064fcp. Leukotriene B4 | C20H32O4 | CID 5280492 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more. Team Associated's Area 51 designers optimized the B4. Hawaii - Trimco pays freight on all orders of $2,000 or more. Rockwood NX2648 door coordinator with filler for 48" openings, black prime coat, standard device size 5/8" x 1-5/8" x 42". Use with the 3815 Rated 20 Minutes Patent #5004277 Can be used with the 3850 Firebolt. For a stop mounted coordinator for a 90" wide opening in black, specify or order: 3094B4. Governor is RUSSELL WILLIAM TREMBLAY. Click to view other data about this site. Trimco Door Protectors:. Sender RS: PRIZM-4B4U-RUQM-ZTVP-ZRUCH. Trimco Logos In. 626/630 1094sp. * * nuevos con goma original sin señal de charnela. All Stores >. advertisement. Whereas in a CMYK color space, it is composed of 73. If the templates that you are looking for are not listed, please call (323-262-4191 ext. Intermediate pivots: Ives #7215-INT, or Kawneer standard intermediate pivot. 's products and customers. This corpus is based on first hand data obtained in the fieldwork in the respective areas. Get the latest trimco logo designs. EXAMPLE For a stop mounted coordinator for a 90" wide opening in black, specify or order: 3094B4. Mounts at top corner of wood door. Wir begrüssen Sie bei der TRIMCO GmbH in Uitikon. b4nny streams live on Twitch! Check out their videos, sign up to chat, and join their community. Mg1 Ox=465541 gn=M444_30535 pe=4 sv=1 mplallalaigafgigttefvimgllpevaadygvtiptagflvtgyalgvvlgaplmtv. E-Mail [email protected] 4B Platform Windows 10, i7 4ghz cpu, 16gb ram, nvidia 1070gtx gpu, 3x 4k Dell monitors. 4 Type 25 Br, Bz, PI, SS Semi-Automatic Flushbolt Wood Doors - For use at top of the inactive leaf of wood doors. cust atlas-s. Subtype: 0. Division 08 Section "Aluminum-Framed Entrances and Storefronts" for storefront systems that incorporate all-glass entrance doors. Trimco 1555 Closet Ball Catch, Satin Chrome. Choose from a list of 1 trimco logo vectors to download logo types and their logo vector files in AI, EPS, CDR & SVG Formats along with their jpg or png logo images. Русское радио: Золотой граммофон. Phone: (416) 755-0001. Trimco - Twister T4 Trimmer 180/day to rent. Can't find what you are looking for? Please fill out our non-stock/special order form and we'll get right back to you. 17 Trimco 1559A Cast Strike, Dark Oxidized. 6 data sheet : EMMICRO, alldatasheet, datasheet, datesheet ricerca nel sito per componenti elettronici ed i semiconduttori e gli altri semiconduttori. Скачать песню Emma Jensen - Me B4 U бесплатно в mp3. As well as, all your harvest, processing, and post harvest needs. Save on Trimco 3094B2 UL Stop Mounted Coordinator, Special Finish from BuildersSale. CDR Vector Formats For Free Download. 96 Trimco 3810 Automatic Flushbolt Single Metal Door UL, Satin Chromium/Satin Stainless. Buy Trimco 1270WV. _widgetsettings. 3% cyan, 17. 4B Platform Windows 10, i7 4ghz cpu, 16gb ram, nvidia 1070gtx gpu, 3x 4k Dell monitors. Zkontrolujte číslo VIN: YV2A4B3C5WA278654 a dozvědět se více o historii poškození tohoto vozidla. To Purchase # 3094S. O&O Defrag Professional 23. Fully automatic, the 3094 Stop-Mounted Coordinators are used to sequence pairs of doors where one leaf must close before the other. SOLID BASEBOARD STOPS. Intermediate pivots: Ives #7215-INT, or Kawneer standard intermediate pivot. 4B 芯片手册, TFZV2. This banner text can have markup. This corpus is based on first hand data obtained in the fieldwork in the respective areas. TRIMCO # OA SW M 3095 3-1/4" x 5" 7/8" - 2-1/4" Steel 600 Black Mounting Bracket For mounting stop-applied hardware. Latest posts. Similar businesses near Trimco: 1 New Things LLC. • Adjustable over-ride prevents “rac> ng hinges" or damage to door, coordinator or frame. 605 1580m10-p-lh. Searches web pages, images, PDF, MS Office and other file types in all the major languages, and includes advanced search features, news, maps and other services. _71B3094 copy #summervacationstyle _71B3094 copy. With many unique and interesting new product. eBay Product ID (ePID). 77b3094d97e34ff2f33755cd5810857660a8cbebe07fe9f3ed8326e9af73f4d3. The patented Trimco 1211 Series Universal Dome Stop is widely used due to its durability and versatility. R50-3094-000. Roller Latches. Product Identifiers. TRIMCO hardware is made with no compromise in quality, design or durability. 630 1191e-5sgt. 4B datasheet, TFZV2. Join Fixya, the easy-to-use, fast & free problem solving service that connects people like trimco04 with experts on everything, wherever they are. In-Store Experience. Fully automatic, the 3094 Stop-Mounted Coordinators are used. When you order products from Anixter. Coordinators, Trim & Auxiliary. Click to view other data about this site. Estimated data, read disclaimer. They are also compatible with panic hardware and may be prepped for most vertical rod panic devices. The 5022 Unit Lock Adapter is a quick and easy retro-fit installation on any door and most manufacturers' unit locks. com, the order is processed within one to two business days. 4B circuit, TFZV2. View Manufacturer Profile Where to buy. thebuilderssupply. 2017 was a fantastic year of growth and further transformation for Trimco. Trimco Interior Design. The override helps prevent damage to the doors, coordinator, frame and hinges in the event the active leaf is forced to close before the inactive leaf. Team Associated's Area 51 designers optimized the B4. THE NATIONAL CONSTRUCTION AUTHORITY ACT (No. BLACK - 52" Coordinator with Filler Bar, Openings 87" to 95" COORDINATOR,STP MTD,87-95,UL, Black Usually Ships in 3-4 Weeks List Price: $345. Stop Mounted, Bar Type, Coordinators, Trim & Auxiliary. Save on Trimco 3094B2 UL Stop Mounted Coordinator, Special Finish from BuildersSale. Trimco manufactures custom door hardware and architectural hardware including elegant door pulls, heavy duty and anti-vandal products, push and pull plates, kick plates and door stops. Радио DFM: D-Чарт. When you order products from Anixter. Trimco is a manufacturer of door hardware, with manufacturing locations in Los Angeles, CA and Columbus, OH. S&P500 Closing milestone - 3094. zhlédnutí 70. 622 1194-2o. Its commercial refrigeration products are sold right to customers worldwide, and have become a by-word for quality, reliability and efficiency. * * nuevos con goma original sin señal de charnela. Transaction. Trimco 3094 Retracting Door Coordinator - Stop Mount Model: 3094 TRIMCO specializes in top-quality hardware for public buildings, schools, offices, hospitals, and retail stores. Zen Cart! G5521BkSL = B5521BkSL Highlight Brush pointed [H3094] - Features: Pointed tip carefully designed and offering good control. One size universal coordinator for all pairs of doors up to 8' wide, available in matte black finish. TRIMCO hardware is made with no compromise in quality, design or durability. black 1191l-5j. Trimco Door Protectors:. We enjoy helping our customers transform their homes. Not all templates are available online. Engineered for use with equal or unequal pairs of doors and with an adjustable override feature to prevent damage to the doors, coordinator, frame and hinges in the event the active leaf is forced to close, Trimco’s 3094 Series is the most flexible and durable coordinator on the market. Home >> Trimco Carpentry. Templates are available at www. 交易 06390ff6667ec6daa977efe0c26cc176fb2a26813712b0d071a9c3eb3094a6eb. Answered all the questions that I had. Estimated data, read disclaimer. EXAMPLE For a stop mounted coordinator for a 90" wide opening in black, specify or order: 3094B4. 00 • Requires low closing force. Printer Ender5 Reproduction steps Issue1 (4. 612 1001-11. 3316, For hand-operated sockets and accessories with square drive as per DIN 3120, Country of Origin: Germany, 3/8 29 mm GEDORE 3094 Coupler Tools & Equipment Wrenches, to DIN 3122, to DIN 3122, GEDORE 3094 Coupler, ISO 1174. We have been able to blend the best of the wholesale distribution model, contract house, high end showroom, and hollow metal door and frame fabrication in order to serve our wide range of customers. 622 1194-2o. Trimco Door Protectors:. An industry leader, TRIMCO offers the broadest array of heavy-duty and functional trim products in the industry. 626/630 1094sp. Trimco - 1064 Pocket Door Pull - Passage 626: Satin Chrome Plated. Cylindrical-coordinate representations (also known as HSL) of color #3094b4 hue: 0. The bristles are a mix of blue squirrel and goat. Amount NQT: 100. As well as, all your harvest, processing, and post harvest needs. Whereas in a CMYK color space, it is composed of 73. (trimco millwork – building addition – east side) (drh18-00271) the fire sprinkler system is used for unlimited area of the building. tomotaka matuda. The company has evolved to become a recognized leader in the design and development of automotive, industrial and custom extrusions. TxReceipt Status: Success. Unit Pricing Data: Trimco Millwork Price Lists Trimco Millwork, Aug 2019, Website. We connect people with their community, while easing traffic congestion and reducing air pollution—making the Portland area a better place to live. Don-Jo # Hager Ives Ives Rockwood Trimco ABH GJ 2011 COR 900 3094A2 2012 COR 900 3094B1 2021 297D COR 900 1660/1672 3094B2 2022 COR 900 3094B3 2023 297D COR 900 1696 3094B4 2033 COR 900 3094C4 2040 1700 3092 2050 297N MB1 901/905 1601C 3096 2051 297M MB2 902/906 1601AB 3095 2060 297C CB1 1100 3090 2080 298D CORG7 469 576 3093 3023 14013 4023 413S. Leukotriene B4 | C20H32O4 | CID 5280492 - structure, chemical names, physical and chemical properties, classification, patents, literature, biological activities, safety/hazards/toxicity information, supplier lists, and more. 00 • Requires low closing force. Поделиться на Facebook. Hà Nội City, Vietnam. Click to view other data about this site. In conjunction with3094. This corpus is based on first hand data obtained in the fieldwork in the respective areas. A Legacy Brand. 이 전화번호(0220603094 / 02-2060-3094)에 대한 정보를 공유해주세요. Must have an open account with Trimco. BLACK - 52" Coordinator with Filler Bar, Openings 87" to 95" COORDINATOR,STP MTD,87-95,UL, Black Usually Ships in 3-4 Weeks List Price: $345. Get the real city bus driver feeling in City Bus Coach SIM 3! Transport the citizens to their stop and earn big money to upgrade your bus or even buy a bigger. 3094B4 = 87-95. TRIMCO # 1229A OA 1/2" x 1/2" BHMA L03011 Silencers for Metal Frames Sold in multiples of 100 TRIMCO# 1229EL H 1/4" D 1-1/8” Elevator Bumper - Grey Sold in multiples of 125 TRIMCO# 1235 B 1-3/8” P 2-15/16” BHMA L02041 Br, Bz, Pl Base Stop - Cast WS ADAPTERS, STOPS AND SILENCERS. 8% red, 58% green and 70. Mg1 Ox=465541 gn=M444_30535 pe=4 sv=1 mplallalaigafgigttefvimgllpevaadygvtiptagflvtgyalgvvlgaplmtv. Current domains or locations: Support the Internet Bill of Rights Vanquish the Panopticon of Ads Support Freedom on the Internet. Transaction. * Hours "Trimco Carpentry" indicated for the examination and may not coincide with the real! You can specify the time by phone (416) 755-0001. They are also recommended for use with the Trimco Manual Flush bolt assemblies. Its commercial refrigeration products are sold right to customers worldwide, and have become a by-word for quality, reliability and efficiency. Zkontrolujte číslo VIN: YV2A4B3C5WA278654 a dozvědět se více o historii poškození tohoto vozidla. 3094B4-87-95" Opening $145. Trimco is a well-respected, Portuguese refrigeration company that has been producing quality fridges for many years. 4B Platform Windows 10, i7 4ghz cpu, 16gb ram, nvidia 1070gtx gpu, 3x 4k Dell monitors. Trimco International Holdings Limited manufactures garment labels, tags, and trimming products for blue chip global apparel companies. 622 1194-2o. d46b3094de31df4733dc6d6e76f3c3df. When you order products from Anixter. com, the order is processed within one to two business days. • Engineered to greatly reduce operating noise levels. INFORMATION. Quality- Without the Hassle. Builders’ Hardware has been in business for 60 years and prides itself on being a very unique company within the hardware industry. Trimco is a door hardware specialist and offers variety of solutions under one roof. Application version 4. 8% red, 58% green and 70. Online Ordering: see inside back cover, complete and fax. 472 Newbold Street N6E 1K6 London. Get the real city bus driver feeling in City Bus Coach SIM 3! Transport the citizens to their stop and earn big money to upgrade your bus or even buy a bigger. Display Fridges from Refrigeration Freezers. TRIMCO# 1562A Trimco PUSH/PULL LATCHES TRIMCO# 1562AE TRIMCO# BS BS STR 5" (1505) 2-3/4" (3651) Br, Bz, PI, SS BS STR 5" (1505) 2-3/4" (3651) Br, Bz, PI Push/Pull Latch Levers Down ADA/© UL Listed TRIMCO# 1562Q or 1562M Exit Only Latch ADA Lever Down Exit / Entrance Only Used when only one side of opening is designed for entrance or exit. Coordinators, Trim & Auxiliary.